Lineage for d4mf4e_ (4mf4 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838329Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2838330Protein automated matches [190614] (15 species)
    not a true protein
  7. 2838370Species Burkholderia cenocepacia [TaxId:216591] [227802] (1 PDB entry)
  8. 2838375Domain d4mf4e_: 4mf4 E: [227804]
    automated match to d3qz6a_
    complexed with edo

Details for d4mf4e_

PDB Entry: 4mf4 (more details), 2 Å

PDB Description: Crystal structure of a HpcH/Hpal aldolase/citrate lyase family protein from Burkholderia cenocepacia J2315
PDB Compounds: (E:) HpcH/HpaI aldolase/citrate lyase family protein

SCOPe Domain Sequences for d4mf4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mf4e_ c.1.12.0 (E:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tnslkqrlrdgdeplyglwlslgsdsaaealahagydwlcidmehapndsrdvasqlrai
aaahlpsepvvrvparepwlvkraldagartlmfpcietpddaahavrltrfpspespdg
lrgvagmvraaafgmrrdylqtanaqvavivqvesargvdeveriaatpgvdclfvgpad
laaslghlgdirhpdvetamarvlaagkqagvavgifagdtaaarqyreagyrlitvsad
vswllratrqalqevrs

SCOPe Domain Coordinates for d4mf4e_:

Click to download the PDB-style file with coordinates for d4mf4e_.
(The format of our PDB-style files is described here.)

Timeline for d4mf4e_: