![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (19 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries) |
![]() | Domain d4m1dm1: 4m1d M:2-106A [227799] Other proteins in same PDB: d4m1dh1, d4m1dh2, d4m1di1, d4m1di2 automated match to d1yuha1 complexed with gol |
PDB Entry: 4m1d (more details), 1.8 Å
SCOPe Domain Sequences for d4m1dm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m1dm1 b.1.1.0 (M:2-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]} svltqppsvsaapgqkvtiscsgsssnignnyvlwyqqfpgtapklliygnnkrpsgipd rfsgsksgtsatlgitglqtgdeadyfcatwdsglsadwvfgggtkltvl
Timeline for d4m1dm1: