Lineage for d4lspl2 (4lsp L:108-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517359Domain d4lspl2: 4lsp L:108-212 [227796]
    Other proteins in same PDB: d4lspl1
    automated match to d1g9ml2
    complexed with edo, na, nag, peg, so4

Details for d4lspl2

PDB Entry: 4lsp (more details), 2.15 Å

PDB Description: Crystal structure of broadly and potently neutralizing antibody VRC-CH31 in complex with HIV-1 clade A/E gp120 93TH057
PDB Compounds: (L:) light chain of antibody vrc-ch31

SCOPe Domain Sequences for d4lspl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lspl2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d4lspl2:

Click to download the PDB-style file with coordinates for d4lspl2.
(The format of our PDB-style files is described here.)

Timeline for d4lspl2: