Lineage for d4m1dh1 (4m1d H:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2739966Species Human (Homo sapiens), cluster 4 [TaxId:9606] [101505] (4 PDB entries)
  8. 2739967Domain d4m1dh1: 4m1d H:1-113 [227791]
    Other proteins in same PDB: d4m1dh2, d4m1di2, d4m1dl1, d4m1dl2, d4m1dm1, d4m1dm2
    automated match to d1q1jh1
    complexed with gol

Details for d4m1dh1

PDB Entry: 4m1d (more details), 1.8 Å

PDB Description: Crystal structure of anti-HIV-1 Fab 447-52D in complex with V3 cyclic peptide MN
PDB Compounds: (H:) Fab mAb 447-52D Heavy Chain

SCOPe Domain Sequences for d4m1dh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1dh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]}
evqlvesggglvkpggslrltcvasgftfsdvwlnwvrqapgkglewvgriksrtdggtt
dyaasvkgrftisrddskntlylqmnslktedtavyscttdgfimirgvsedyyyyymdv
wgkgttvtvss

SCOPe Domain Coordinates for d4m1dh1:

Click to download the PDB-style file with coordinates for d4m1dh1.
(The format of our PDB-style files is described here.)

Timeline for d4m1dh1: