SCOPe 2.08: Domain d4l1qc1: 4l1q C:7-131

Lineage for d4l1qc1 (4l1q C:7-131)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (3 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (9 PDB entries)

8. Domain d4l1qc1: 4l1q C:7-131 [227759]
   Other proteins in same PDB: d4l1qc2
   automated match to d3rlmc_
   complexed with ca, edo, hec, mes, na

Details for d4l1qc1

PDB Entry: 4l1q, 1.92 Å

PDB Description: Crystal Structure of the E113Q-MauG/pre-Methylamine Dehydrogenase Complex

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4l1qc1:

Sequence; same for both SEQRES and ATOM records:

>d4l1qc1 g.21.1.1 (C:7-131) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d4l1qc1:

• d4l1qc1 first appeared in SCOPe 2.03, called d4l1qc_
  
• d4l1qc1 appears in SCOPe 2.07