SCOPe 2.06: Domain d4kn3a_: 4kn3 A:

Lineage for d4kn3a_ (4kn3 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Amphitrite ornata [TaxId:129555] [189339] (9 PDB entries)

8. Domain d4kn3a_: 4kn3 A: [227753]
   automated match to d3lb2a_
   complexed with hem, so4, t6c; mutant

Details for d4kn3a_

PDB Entry: 4kn3, 1.78 Å

PDB Description: structure of the y34ns91g double mutant of dehaloperoxidase from amphitrite ornata with 2,4,6-trichlorophenol

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d4kn3a_:

Sequence; same for both SEQRES and ATOM records:

>d4kn3a_ a.1.1.2 (A:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d4kn3a_:

• d4kn3a_ first appeared in SCOPe 2.03
  
• d4kn3a_ appears in SCOPe 2.05
  
• d4kn3a_ appears in SCOPe 2.07
  
• d4kn3a_ appears in the current release, SCOPe 2.08