Lineage for d4irsc2 (4irs C:115-203)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031142Domain d4irsc2: 4irs C:115-203 [227718]
    Other proteins in same PDB: d4irsa1, d4irsb_, d4irsc1, d4irsd1
    automated match to d3o8xc2
    complexed with 1la, nag

Details for d4irsc2

PDB Entry: 4irs (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-pyrc-alpha-galcer-inkt tcr complex
PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irsc2:

Sequence, based on SEQRES records: (download)

>d4irsc2 b.1.1.2 (C:115-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d4irsc2 b.1.1.2 (C:115-203) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d4irsc2:

Click to download the PDB-style file with coordinates for d4irsc2.
(The format of our PDB-style files is described here.)

Timeline for d4irsc2: