Lineage for d4irsc1 (4irs C:1-114)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297077Domain d4irsc1: 4irs C:1-114 [227716]
    Other proteins in same PDB: d4irsa1, d4irsa2, d4irsb_, d4irsc2, d4irsd1, d4irsd2
    automated match to d3o8xc1
    complexed with 1la, nag

Details for d4irsc1

PDB Entry: 4irs (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-pyrc-alpha-galcer-inkt tcr complex
PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d4irsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irsc1 b.1.1.0 (C:1-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d4irsc1:

Click to download the PDB-style file with coordinates for d4irsc1.
(The format of our PDB-style files is described here.)

Timeline for d4irsc1: