Lineage for d4bg4a1 (4bg4 A:1-95)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004454Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2004455Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2004520Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2004521Protein automated matches [226884] (7 species)
    not a true protein
  7. 2004589Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227655] (3 PDB entries)
  8. 2004591Domain d4bg4a1: 4bg4 A:1-95 [227656]
    Other proteins in same PDB: d4bg4a2, d4bg4b2
    automated match to d1m15a1
    complexed with adp, arg, bme, mg, no3

Details for d4bg4a1

PDB Entry: 4bg4 (more details), 1.6 Å

PDB Description: crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4bg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bg4a1 a.83.1.0 (A:1-95) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
madaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgven
ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkq

SCOPe Domain Coordinates for d4bg4a1:

Click to download the PDB-style file with coordinates for d4bg4a1.
(The format of our PDB-style files is described here.)

Timeline for d4bg4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bg4a2