SCOPe 2.03: Domain d4b7vb2: 4b7v B:253-413

Lineage for d4b7vb2 (4b7v B:253-413)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (40 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [227637] (2 PDB entries)

8. Domain d4b7vb2: 4b7v B:253-413 [227641]
   automated match to d3o04a2
   complexed with k

Details for d4b7vb2

PDB Entry: 4b7v, 1.73 Å

PDB Description: structure of wild type pseudomonas aeruginosa fabf (kasii)

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4b7vb2:

Sequence; same for both SEQRES and ATOM records:

>d4b7vb2 c.95.1.0 (B:253-413) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
riyaelvgfgmsgdafhmtappedgagaarcmknalrdagldprqvdyinahgtstpagd
iaeiaavksvfgehahalsmsstksmtghllgaagaveaifsvlalrdqvapptinldnp
degcdldlvaheakprkidvalsnsfgfggtngtlvfrrfa

Timeline for d4b7vb2:

• d4b7vb2 is new in SCOPe 2.03-stable
  
• d4b7vb2 appears in SCOPe 2.04
  
• d4b7vb2 appears in the current release, SCOPe 2.08