SCOPe 2.03: Domain d2ymzc_: 2ymz C:

Lineage for d2ymzc_ (2ymz C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (23 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [227626] (1 PDB entry)

8. Domain d2ymzc_: 2ymz C: [227632]
   automated match to d1hlca_
   complexed with lat, so4

Details for d2ymzc_

PDB Entry: 2ymz, 1.75 Å

PDB Description: crystal structure of chicken galectin 2

PDB Compounds: (C:) galectin 2

SCOPe Domain Sequences for d2ymzc_:

Sequence; same for both SEQRES and ATOM records:

>d2ymzc_ b.29.1.0 (C:) automated matches {Gallus gallus [TaxId: 9031]}
armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
gfkvtsfkve

Timeline for d2ymzc_:

• d2ymzc_ is new in SCOPe 2.03-stable
  
• d2ymzc_ appears in SCOPe 2.04
  
• d2ymzc_ appears in the current release, SCOPe 2.08, called d2ymzc1