Lineage for d2ymzb1 (2ymz B:4-131)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780743Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 2780755Domain d2ymzb1: 2ymz B:4-131 [227631]
    Other proteins in same PDB: d2ymza2, d2ymzb2, d2ymzc2, d2ymzd2, d2ymze2, d2ymzf2
    automated match to d1hlca_
    complexed with so4

Details for d2ymzb1

PDB Entry: 2ymz (more details), 1.75 Å

PDB Description: crystal structure of chicken galectin 2
PDB Compounds: (B:) galectin 2

SCOPe Domain Sequences for d2ymzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymzb1 b.29.1.0 (B:4-131) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslcsd
nwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilggf
kvtsfkve

SCOPe Domain Coordinates for d2ymzb1:

Click to download the PDB-style file with coordinates for d2ymzb1.
(The format of our PDB-style files is described here.)

Timeline for d2ymzb1: