Lineage for d2ymza_ (2ymz A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781877Species Chicken (Gallus gallus) [TaxId:9031] [227626] (3 PDB entries)
  8. 1781879Domain d2ymza_: 2ymz A: [227630]
    automated match to d1hlca_
    complexed with lat, so4

Details for d2ymza_

PDB Entry: 2ymz (more details), 1.75 Å

PDB Description: crystal structure of chicken galectin 2
PDB Compounds: (A:) galectin 2

SCOPe Domain Sequences for d2ymza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymza_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
gfkvtsfkve

SCOPe Domain Coordinates for d2ymza_:

Click to download the PDB-style file with coordinates for d2ymza_.
(The format of our PDB-style files is described here.)

Timeline for d2ymza_: