Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [227626] (4 PDB entries) |
Domain d2ymze1: 2ymz E:4-131 [227628] Other proteins in same PDB: d2ymza2, d2ymzb2, d2ymzc2, d2ymzd2, d2ymze2, d2ymzf2 automated match to d1hlca_ complexed with lat, so4 |
PDB Entry: 2ymz (more details), 1.75 Å
SCOPe Domain Sequences for d2ymze1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ymze1 b.29.1.0 (E:4-131) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslcsd nwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilggf kvtsfkve
Timeline for d2ymze1: