SCOPe 2.06: Domain d2ymze1: 2ymz E:4-131

Lineage for d2ymze1 (2ymz E:4-131)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [227626] (4 PDB entries)

8. Domain d2ymze1: 2ymz E:4-131 [227628]
   Other proteins in same PDB: d2ymza2, d2ymzb2, d2ymzc2, d2ymzd2, d2ymze2, d2ymzf2
   automated match to d1hlca_
   complexed with lat, so4

Details for d2ymze1

PDB Entry: 2ymz, 1.75 Å

PDB Description: crystal structure of chicken galectin 2

PDB Compounds: (E:) galectin 2

SCOPe Domain Sequences for d2ymze1:

Sequence; same for both SEQRES and ATOM records:

>d2ymze1 b.29.1.0 (E:4-131) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslcsd
nwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilggf
kvtsfkve

Timeline for d2ymze1:

• d2ymze1 first appeared in SCOPe 2.03, called d2ymze_
  
• d2ymze1 was called d2ymze_ in SCOPe 2.05
  
• d2ymze1 appears in SCOPe 2.07
  
• d2ymze1 appears in the current release, SCOPe 2.08