Lineage for d4maxb_ (4max B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976412Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1976472Protein automated matches [190322] (4 species)
    not a true protein
  7. 1976483Species Synechococcus sp. [TaxId:32049] [194261] (4 PDB entries)
  8. 1976488Domain d4maxb_: 4max B: [227624]
    automated match to d4l2mb_
    complexed with heb, so4

Details for d4maxb_

PDB Entry: 4max (more details), 1.44 Å

PDB Description: Crystal structure of Synechococcus sp. PCC 7002 globin at cryogenic temperature with heme modification
PDB Compounds: (B:) Cyanoglobin

SCOPe Domain Sequences for d4maxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4maxb_ a.1.1.1 (B:) automated matches {Synechococcus sp. [TaxId: 32049]}
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr

SCOPe Domain Coordinates for d4maxb_:

Click to download the PDB-style file with coordinates for d4maxb_.
(The format of our PDB-style files is described here.)

Timeline for d4maxb_: