Lineage for d4kzvb_ (4kzv B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1442549Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1442550Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1443240Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1443241Protein automated matches [190159] (8 species)
    not a true protein
  7. 1443242Species Bos taurus [TaxId:9913] [227618] (2 PDB entries)
  8. 1443244Domain d4kzvb_: 4kzv B: [227621]
    automated match to d3hupb_
    complexed with ca, na, tre

Details for d4kzvb_

PDB Entry: 4kzv (more details), 1.4 Å

PDB Description: structure of the carbohydrate-recognition domain of the c-type lectin mincle bound to trehalose
PDB Compounds: (B:) C-type lectin mincle

SCOPe Domain Sequences for d4kzvb_:

Sequence, based on SEQRES records: (download)

>d4kzvb_ d.169.1.0 (B:) automated matches {Bos taurus [TaxId: 9913]}
acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
igltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcf
fnmfrvcemper

Sequence, based on observed residues (ATOM records): (download)

>d4kzvb_ d.169.1.0 (B:) automated matches {Bos taurus [TaxId: 9913]}
acplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefy
igltdqvtegqwqwvdgtpftkslsfwdagepnndcatirdssnprqnwndvpcffnmfr
vcemper

SCOPe Domain Coordinates for d4kzvb_:

Click to download the PDB-style file with coordinates for d4kzvb_.
(The format of our PDB-style files is described here.)

Timeline for d4kzvb_: