SCOPe 2.03: Domain d4je4a_: 4je4 A:

Lineage for d4je4a_ (4je4 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (7 PDB entries)

8. Domain d4je4a_: 4je4 A: [227617]
   automated match to d2fcia1

Details for d4je4a_

PDB Entry: 4je4, 2.31 Å

PDB Description: Crystal Structure of Monobody NSa1/SHP2 N-SH2 Domain Complex

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 11

SCOPe Domain Sequences for d4je4a_:

Sequence; same for both SEQRES and ATOM records:

>d4je4a_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
ydlyggekfatlaelvqyymehhgqlkekngdvielkyplnk

Timeline for d4je4a_:

• d4je4a_ is new in SCOPe 2.03-stable
  
• d4je4a_ appears in SCOPe 2.04
  
• d4je4a_ appears in the current release, SCOPe 2.08, called d4je4a1