SCOPe 2.04: Domain d4jzfl_: 4jzf L:

Lineage for d4jzfl_ (4jzf L:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (45 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d4jzfl_: 4jzf L: [227607]
   Other proteins in same PDB: d4jzfh_
   automated match to d1w7xl_
   complexed with 1nl, ca, gol, so4

Details for d4jzfl_

PDB Entry: 4jzf, 1.84 Å

PDB Description: Structure of factor VIIA in complex with the inhibitor 2-{2-[(3-carbamoylphenyl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2S)-1-hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid

PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d4jzfl_:

Sequence; same for both SEQRES and ATOM records:

>d4jzfl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4jzfl_:

• d4jzfl_ first appeared in SCOPe 2.03
  
• d4jzfl_ appears in SCOPe 2.05
  
• d4jzfl_ appears in the current release, SCOPe 2.08