SCOPe 2.06: Domain d4kaxa1: 4kax A:14-173

Lineage for d4kaxa1 (4kax A:14-173)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
   Uniprot P32889

8. Domain d4kaxa1: 4kax A:14-173 [227592]
   Other proteins in same PDB: d4kaxa2, d4kaxa3, d4kaxb_
   automated match to d1o3ya_
   complexed with 4ip, cit, gol, gtp, k, mg

Details for d4kaxa1

PDB Entry: 4kax, 1.85 Å

PDB Description: crystal structure of the grp1 ph domain in complex with arf6-gtp

PDB Compounds: (A:) ADP-ribosylation factor 6

SCOPe Domain Sequences for d4kaxa1:

Sequence; same for both SEQRES and ATOM records:

>d4kaxa1 c.37.1.8 (A:14-173) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggldkirpl
wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
eiqeklgltrirdrnwyvqpscatsgdglyegltwltsny

Timeline for d4kaxa1:

• d4kaxa1 first appeared in SCOPe 2.03, called d4kaxa_
  
• d4kaxa1 was called d4kaxa_ in SCOPe 2.05
  
• d4kaxa1 appears in SCOPe 2.07
  
• d4kaxa1 appears in the current release, SCOPe 2.08