SCOPe 2.08: Domain d4dhna1: 4dhn A:1-231

Lineage for d4dhna1 (4dhn A:1-231)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)

8. Domain d4dhna1: 4dhn A:1-231 [227565]
   Other proteins in same PDB: d4dhna2
   automated match to d3p1oa_
   complexed with 0kc, cl, gol, mg

Details for d4dhna1

PDB Entry: 4dhn, 1.8 Å

PDB Description: Small-molecule inhibitors of 14-3-3 protein-protein interactions from virtual screening

PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d4dhna1:

Sequence, based on SEQRES records:

>d4dhna1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records):

>d4dhna1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdy
yrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeiansp
eeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Timeline for d4dhna1:

• d4dhna1 first appeared in SCOPe 2.03, called d4dhna_
  
• d4dhna1 appears in SCOPe 2.07