SCOPe 2.04: Domain d4kdoe_: 4kdo E:

Lineage for d4kdoe_ (4kdo E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)

8. Domain d4kdoe_: 4kdo E: [227559]
   Other proteins in same PDB: d4kdob_, d4kdod_, d4kdof_
   automated match to d4kpsa_
   complexed with nag, sia

Details for d4kdoe_

PDB Entry: 4kdo, 2.4 Å

PDB Description: crystal structure of the hemagglutinin of ferret-transmissible h5n1 virus in complex with human receptor analog lstc

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4kdoe_:

Sequence; same for both SEQRES and ATOM records:

>d4kdoe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
qdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlaiglrnsp

Timeline for d4kdoe_:

• d4kdoe_ first appeared in SCOPe 2.03
  
• d4kdoe_ appears in SCOPe 2.05
  
• d4kdoe_ appears in the current release, SCOPe 2.08, called d4kdoe1