Class b: All beta proteins [48724] (177 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (9 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries) |
Domain d4kdna1: 4kdn A:5-325 [227552] Other proteins in same PDB: d4kdna2, d4kdnb_, d4kdnc2, d4kdnd_, d4kdne2, d4kdnf_ automated match to d4kpsa_ complexed with nag, sia |
PDB Entry: 4kdn (more details), 2.48 Å
SCOPe Domain Sequences for d4kdna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdna1 b.19.1.2 (A:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlaiglrnsp
Timeline for d4kdna1: