Lineage for d4kdna1 (4kdn A:5-325)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047780Domain d4kdna1: 4kdn A:5-325 [227552]
    Other proteins in same PDB: d4kdna2, d4kdnb_, d4kdnc2, d4kdnd_, d4kdne2, d4kdnf_
    automated match to d4kpsa_
    complexed with nag, sia

Details for d4kdna1

PDB Entry: 4kdn (more details), 2.48 Å

PDB Description: crystal structure of the hemagglutinin of ferret-transmissible h5n1 virus in complex with avian receptor analog lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4kdna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdna1 b.19.1.2 (A:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4kdna1:

Click to download the PDB-style file with coordinates for d4kdna1.
(The format of our PDB-style files is described here.)

Timeline for d4kdna1: