SCOPe 2.07: Domain d4l4tg2: 4l4t G:111-199

Lineage for d4l4tg2 (4l4t G:111-199)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4l4tg2: 4l4t G:111-199 [227540]
   Other proteins in same PDB: d4l4ta1, d4l4ta2, d4l4ta3, d4l4tb_, d4l4tc1, d4l4tc2, d4l4tc3, d4l4td1, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4th1, d4l4th2
   automated match to d2f54d2
   complexed with 6fp

Details for d4l4tg2

PDB Entry: 4l4t, 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP

PDB Compounds: (G:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d4l4tg2:

Sequence, based on SEQRES records:

>d4l4tg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4l4tg2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
sndfacanafnnsiipedtffps

Timeline for d4l4tg2:

• d4l4tg2 first appeared in SCOPe 2.03
  
• d4l4tg2 appears in SCOPe 2.06
  
• d4l4tg2 appears in the current release, SCOPe 2.08