Lineage for d4l4td2 (4l4t D:111-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750035Domain d4l4td2: 4l4t D:111-200 [227538]
    Other proteins in same PDB: d4l4ta1, d4l4ta2, d4l4ta3, d4l4tb_, d4l4tc1, d4l4tc2, d4l4tc3, d4l4td1, d4l4te1, d4l4te2, d4l4tf_, d4l4tg1, d4l4th1, d4l4th2
    automated match to d2f54d2
    complexed with 6fp

Details for d4l4td2

PDB Entry: 4l4t (more details), 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP
PDB Compounds: (D:) MAIT T-cell receptor alpha chain

SCOPe Domain Sequences for d4l4td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4td2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d4l4td2:

Click to download the PDB-style file with coordinates for d4l4td2.
(The format of our PDB-style files is described here.)

Timeline for d4l4td2: