Lineage for d4l4th1 (4l4t H:3-116)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365888Domain d4l4th1: 4l4t H:3-116 [227529]
    Other proteins in same PDB: d4l4ta1, d4l4ta3, d4l4tb_, d4l4tc1, d4l4tc3, d4l4td2, d4l4tf_, d4l4tg2
    automated match to d2nw2b1
    complexed with 6fp

Details for d4l4th1

PDB Entry: 4l4t (more details), 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP
PDB Compounds: (H:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d4l4th1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4th1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn
gynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

SCOPe Domain Coordinates for d4l4th1:

Click to download the PDB-style file with coordinates for d4l4th1.
(The format of our PDB-style files is described here.)

Timeline for d4l4th1: