Lineage for d4j56g_ (4j56 G:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852418Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1852482Protein Thioredoxin [52835] (15 species)
  7. 1852662Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)
  8. 1852665Domain d4j56g_: 4j56 G: [227509]
    automated match to d1ep7a_
    complexed with fad

Details for d4j56g_

PDB Entry: 4j56 (more details), 2.37 Å

PDB Description: Structure of Plasmodium falciparum thioredoxin reductase-thioredoxin complex
PDB Compounds: (G:) thioredoxin

SCOPe Domain Sequences for d4j56g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j56g_ c.47.1.1 (G:) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
gsvkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvde
vsevtekenitsmptfkvykngssvdtllgandsalkqliekyaa

SCOPe Domain Coordinates for d4j56g_:

Click to download the PDB-style file with coordinates for d4j56g_.
(The format of our PDB-style files is described here.)

Timeline for d4j56g_: