SCOPe 2.08: Domain d4j56g1: 4j56 G:2-104

Lineage for d4j56g1 (4j56 G:2-104)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)

8. Domain d4j56g1: 4j56 G:2-104 [227509]
   Other proteins in same PDB: d4j56e2, d4j56f2, d4j56g2, d4j56h2
   automated match to d1ep7a_
   complexed with fad

Details for d4j56g1

PDB Entry: 4j56, 2.37 Å

PDB Description: Structure of Plasmodium falciparum thioredoxin reductase-thioredoxin complex

PDB Compounds: (G:) thioredoxin

SCOPe Domain Sequences for d4j56g1:

Sequence; same for both SEQRES and ATOM records:

>d4j56g1 c.47.1.1 (G:2-104) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekyaa

Timeline for d4j56g1:

• d4j56g1 first appeared in SCOPe 2.03, called d4j56g_
  
• d4j56g1 appears in SCOPe 2.07