SCOPe 2.03: Domain d4j57e_: 4j57 E:

Lineage for d4j57e_ (4j57 E:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (15 species)

7. Species Plasmodium falciparum [TaxId:36329] [227500] (2 PDB entries)

8. Domain d4j57e_: 4j57 E: [227504]
   automated match to d1ep7a_
   complexed with fad, gol

Details for d4j57e_

PDB Entry: 4j57, 2.5 Å

PDB Description: structure of plasmodium falciparum thioredoxin reductase-thioredoxin complex

PDB Compounds: (E:) thioredoxin

SCOPe Domain Sequences for d4j57e_:

Sequence; same for both SEQRES and ATOM records:

>d4j57e_ c.47.1.1 (E:) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekyaa

Timeline for d4j57e_:

• d4j57e_ is new in SCOPe 2.03-stable
  
• d4j57e_ appears in SCOPe 2.04
  
• d4j57e_ appears in the current release, SCOPe 2.08