SCOPe 2.08: Domain d4eroa_: 4ero A:

Lineage for d4eroa_ (4ero A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.12: Pirin-like [101984] (2 proteins)
   Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin

6. Protein Pirin [101985] (1 species)
   Bcl-3 and nuclear factor I-interacting protein

7. Species Human (Homo sapiens) [TaxId:9606] [101986] (13 PDB entries)

8. Domain d4eroa_: 4ero A: [227465]
   automated match to d1j1la_
   complexed with co, edo

Details for d4eroa_

PDB Entry: 4ero, 2.65 Å

PDB Description: Study on structure and function relationships in human Pirin with Cobalt ion

PDB Compounds: (A:) Pirin

SCOPe Domain Sequences for d4eroa_:

Sequence; same for both SEQRES and ATOM records:

>d4eroa_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]}
sskkvtlsvlsreqsegvgarvrrsigrpelknldpfllfdefkggrpggfpdhphrgfe
tvsylleggsmahedfcghtgkmnpgdlqwmtagrgilhaempcseepahglqlwvnlrs
sekmvepqyqelkseeipkpskdgvtvavisgealgikskvytrtptlyldfkldpgakh
sqpipkgwtsfiytisgdvyigpddaqqkiephhtavlgegdsvqvenkdpkrshfvlia
geplrepviqhgpfvmntneeisqaildfrnakngferaktwkskign

Timeline for d4eroa_:

• d4eroa_ first appeared in SCOPe 2.03
  
• d4eroa_ appears in SCOPe 2.07