Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (76 PDB entries) |
Domain d4ej1c_: 4ej1 C: [227458] Other proteins in same PDB: d4ej1a_, d4ej1b_ automated match to d4eizd_ complexed with fol, po4 |
PDB Entry: 4ej1 (more details), 1.75 Å
SCOPe Domain Sequences for d4ej1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ej1c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]} qlqesggglvqaggslrlsctasgrtfssyamgwfrqtpgkerefvaaitwggsttlyad svkgrftmsrdnakntvylqmnslkpedtavyycaadgsqyrstysfrdkpdygswgqgt qvtvss
Timeline for d4ej1c_: