Lineage for d4ej1d_ (4ej1 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758317Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)
  8. 1758375Domain d4ej1d_: 4ej1 D: [227457]
    Other proteins in same PDB: d4ej1a_, d4ej1b_
    automated match to d4eizd_
    complexed with fol, po4

Details for d4ej1d_

PDB Entry: 4ej1 (more details), 1.75 Å

PDB Description: Binding of Nb113 camelid antibody fragment with the binary DHFR:folate complex
PDB Compounds: (D:) Nb113 camelid antibody fragment

SCOPe Domain Sequences for d4ej1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ej1d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qlqesggglvqaggslrlsctasgrtfssyamgwfrqtpgkerefvaaitwggsttlyad
svkgrftmsrdnakntvylqmnslkpedtavyycaadgsqyrstysfrdkpdygswgqgt
qvtvss

SCOPe Domain Coordinates for d4ej1d_:

Click to download the PDB-style file with coordinates for d4ej1d_.
(The format of our PDB-style files is described here.)

Timeline for d4ej1d_: