Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries) |
Domain d4eizc1: 4eiz C:2-127 [227456] Other proteins in same PDB: d4eiza_, d4eizb_, d4eizc2, d4eizd2 automated match to d4eizd_ |
PDB Entry: 4eiz (more details), 2.2 Å
SCOPe Domain Sequences for d4eizc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4eizc1 b.1.1.1 (C:2-127) automated matches {Llama (Lama glama) [TaxId: 9844]} vqlqesggglvqaggslrlsctasgrtfssyamgwfrqtpgkerefvaaitwggsttlya dsvkgrftmsrdnakntvylqmnslkpedtavyycaadgsqyrstysfrdkpdygswgqg tqvtvs
Timeline for d4eizc1:
View in 3D Domains from other chains: (mouse over for more information) d4eiza_, d4eizb_, d4eizd1, d4eizd2 |