Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Acinetobacter baumannii [TaxId:509173] [227366] (8 PDB entries) |
Domain d4fexb_: 4fex B: [227376] automated match to d3tm0a_ complexed with 0to, act, kan, na |
PDB Entry: 4fex (more details), 2.71 Å
SCOPe Domain Sequences for d4fexb_:
Sequence, based on SEQRES records: (download)
>d4fexb_ d.144.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 509173]} hiqretscsrprlnsnldadlygyrwardnvgqsgatiyrlygkpnapelflkhgkgsva ndvtdemvrlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivd alavflrrlhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkem hkllpfspdsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefsps lqkrlfqkygidnpdmnklqfhlmldeff
>d4fexb_ d.144.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 509173]} hiqretscsrprdadlygyrwardnsgatiyrlygkpnapelflkhgkgsvandvtdemv rlnwltafmplptikhfirtpddawllttaipgktafqvleeypdsgenivdalavflrr lhsipvcncpfnsdrvfrlaqaqsrmnnglvdasdfdderngwpveqvwkemhkllpfsp dsvvthgdfsldnlifdegkligcidvgrvgiadryqdlailwnclgefspslqkrlfqk ygidnpdmnklqfhlmldeff
Timeline for d4fexb_:
View in 3D Domains from other chains: (mouse over for more information) d4fexa_, d4fexc_, d4fexd_, d4fexe_ |