SCOPe 2.05: Domain d3qxvd_: 3qxv D:

Lineage for d3qxvd_ (3qxv D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d3qxvd_: 3qxv D: [227342]
   automated match to d3qxve_
   complexed with mtx, so4

Details for d3qxvd_

PDB Entry: 3qxv, 2.5 Å

PDB Description: Structure of an Anti-Methotrexate CDR1-4 Graft VHH Antibody in Complex with Methotrexate

PDB Compounds: (D:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxvd_:

Sequence; same for both SEQRES and ATOM records:

>d3qxvd_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

Timeline for d3qxvd_:

• d3qxvd_ first appeared in SCOPe 2.03
  
• d3qxvd_ appears in SCOPe 2.04
  
• d3qxvd_ appears in SCOPe 2.06
  
• d3qxvd_ appears in the current release, SCOPe 2.08