Lineage for d3qxwe_ (3qxw E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758317Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)
  8. 1758366Domain d3qxwe_: 3qxw E: [227340]
    automated match to d3qxve_
    complexed with na, so4

Details for d3qxwe_

PDB Entry: 3qxw (more details), 1.85 Å

PDB Description: free structure of an anti-methotrexate cdr1-4 graft vhh antibody
PDB Compounds: (E:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxwe_ b.1.1.1 (E:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

SCOPe Domain Coordinates for d3qxwe_:

Click to download the PDB-style file with coordinates for d3qxwe_.
(The format of our PDB-style files is described here.)

Timeline for d3qxwe_: