Lineage for d3qxwb_ (3qxw B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290216Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)
  8. 1290260Domain d3qxwb_: 3qxw B: [227338]
    automated match to d3qxve_
    complexed with na, so4

Details for d3qxwb_

PDB Entry: 3qxw (more details), 1.85 Å

PDB Description: Free structure of an anti-methotrexate CDR1-4 Graft VHH Antibody
PDB Compounds: (B:) Anti-Methotrexate CDR1-4 Graft VHH

SCOPe Domain Sequences for d3qxwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxwb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdnaeylvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

SCOPe Domain Coordinates for d3qxwb_:

Click to download the PDB-style file with coordinates for d3qxwb_.
(The format of our PDB-style files is described here.)

Timeline for d3qxwb_: