Lineage for d2zona1 (2zon A:2-159)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774814Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1775028Protein Nitrite reductase, NIR [49551] (5 species)
    consists of two domains of this fold
  7. 1775247Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (23 PDB entries)
    Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601
  8. 1775258Domain d2zona1: 2zon A:2-159 [227320]
    Other proteins in same PDB: d2zong_
    automated match to d2vw6b1
    complexed with cu, hem

Details for d2zona1

PDB Entry: 2zon (more details), 1.7 Å

PDB Description: Crystal structure of electron transfer complex of nitrite reductase with cytochrome c
PDB Compounds: (A:) dissimilatory copper-containing nitrite reductase

SCOPe Domain Sequences for d2zona1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zona1 b.6.1.3 (A:2-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdp

SCOPe Domain Coordinates for d2zona1:

Click to download the PDB-style file with coordinates for d2zona1.
(The format of our PDB-style files is described here.)

Timeline for d2zona1: