SCOPe 2.03: Domain d3ejzd1: 3ejz D:1-106

Lineage for d3ejzd1 (3ejz D:1-106)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (52 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d3ejzd1: 3ejz D:1-106 [227316]
   Other proteins in same PDB: d3ejzd2, d3ejzf2
   automated match to d1otsd1
   complexed with br; mutant

Details for d3ejzd1

PDB Entry: 3ejz, 2.9 Å

PDB Description: structure of e203v mutant e.coli cl-/h+ exchanger, clc-ec1

PDB Compounds: (D:) Fab fragment, light chain

SCOPe Domain Sequences for d3ejzd1:

Sequence; same for both SEQRES and ATOM records:

>d3ejzd1 b.1.1.1 (D:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d3ejzd1:

• d3ejzd1 is new in SCOPe 2.03-stable
  
• d3ejzd1 appears in SCOPe 2.04
  
• d3ejzd1 appears in the current release, SCOPe 2.08