SCOPe 2.03: Domain d2nyya4: 2nyy A:1080-1295

Lineage for d2nyya4 (2nyy A:1080-1295)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.4: STI-like [50386] (3 families)

5. Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins)
   overall fold is very similar to that of the STI family
   automatically mapped to Pfam PF07951

6. Protein Botulinum neurotoxin [50402] (2 species)

7. Species Clostridium botulinum, serotype A [TaxId:1491] [50403] (3 PDB entries)

8. Domain d2nyya4: 2nyy A:1080-1295 [227310]
   Other proteins in same PDB: d2nyya1, d2nyya2, d2nyya3
   automated match to d3btaa2
   complexed with ca, zn

Details for d2nyya4

PDB Entry: 2nyy, 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1

PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d2nyya4:

Sequence; same for both SEQRES and ATOM records:

>d2nyya4 b.42.4.2 (A:1080-1295) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
nekeikdlydnqsnsgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgp
rgsvmttniylnsslyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasq
agvekilsaleipdvgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnnia
klvasnwynrqierssrtlgcswefipvddgwgerp

Timeline for d2nyya4:

• d2nyya4 is new in SCOPe 2.03-stable
  
• d2nyya4 appears in SCOPe 2.04
  
• d2nyya4 appears in the current release, SCOPe 2.08