Lineage for d2nyya1 (2nyy A:2-547)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2529349Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2529350Protein Botulinum neurotoxin [55513] (4 species)
  7. 2529351Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (28 PDB entries)
    Uniprot P10845 1-419
  8. 2529386Domain d2nyya1: 2nyy A:2-547 [227307]
    Other proteins in same PDB: d2nyya2, d2nyya3, d2nyya4, d2nyyc1, d2nyyc2, d2nyyd1, d2nyyd2, d2nyyd3
    automated match to d3btaa3
    complexed with ca, zn

Details for d2nyya1

PDB Entry: 2nyy (more details), 2.61 Å

PDB Description: crystal structure of botulinum neurotoxin type a complexed with monoclonal antibody cr1
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d2nyya1:

Sequence, based on SEQRES records: (download)

>d2nyya1 d.92.1.7 (A:2-547) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lfefykllcvrgiitsktksldkgynkalndlcikvnnwdlffspsednftndlnkgeei
tsdtnieaaeenisldliqqyyltfnfdnepenisienlssdiigqlelmpnierfpngk
kyeldk

Sequence, based on observed residues (ATOM records): (download)

>d2nyya1 d.92.1.7 (A:2-547) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
pfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdlnp
ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpnr
vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
nrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftg
lfefykllcvrlcikvnnwdlffspsednftndlnkgeeitsdtnieanisldliqqyyl
tfnfdnepenisienlssdiigqlelmpnierfpngkkyeldk

SCOPe Domain Coordinates for d2nyya1:

Click to download the PDB-style file with coordinates for d2nyya1.
(The format of our PDB-style files is described here.)

Timeline for d2nyya1: