Class b: All beta proteins [48724] (165 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) |
Family b.3.3.1: VHL [49469] (1 protein) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (3 PDB entries) |
Domain d1vcbl_: 1vcb L: [22538] Other proteins in same PDB: d1vcba_, d1vcbb_, d1vcbd_, d1vcbe_, d1vcbg_, d1vcbh_, d1vcbj_, d1vcbk_ |
PDB Entry: 1vcb (more details), 2.7 Å
SCOP Domain Sequences for d1vcbl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vcbl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]} lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr slyedledhpnvqkdlerltqe
Timeline for d1vcbl_: