Lineage for d1vcbf_ (1vcb F:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 659818Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 659946Superfamily b.3.3: VHL [49468] (1 family) (S)
  5. 659947Family b.3.3.1: VHL [49469] (1 protein)
  6. 659948Protein VHL [49470] (1 species)
  7. 659949Species Human (Homo sapiens) [TaxId:9606] [49471] (3 PDB entries)
  8. 659953Domain d1vcbf_: 1vcb F: [22536]
    Other proteins in same PDB: d1vcba_, d1vcbb_, d1vcbd_, d1vcbe_, d1vcbg_, d1vcbh_, d1vcbj_, d1vcbk_

Details for d1vcbf_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (F:) protein (vhl)

SCOP Domain Sequences for d1vcbf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbf_ b.3.3.1 (F:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOP Domain Coordinates for d1vcbf_:

Click to download the PDB-style file with coordinates for d1vcbf_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbf_: