Lineage for d5bcac1 (5bca C:418-516)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10502Protein beta-amylase [49462] (1 species)
  7. 10503Species Bacillus cereus [TaxId:1396] [49463] (4 PDB entries)
  8. 10508Domain d5bcac1: 5bca C:418-516 [22531]
    Other proteins in same PDB: d5bcaa2, d5bcab2, d5bcac2, d5bcad2

Details for d5bcac1

PDB Entry: 5bca (more details), 2.2 Å

PDB Description: beta-amylase from bacillus cereus var. mycoides

SCOP Domain Sequences for d5bcac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bcac1 b.3.1.1 (C:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOP Domain Coordinates for d5bcac1:

Click to download the PDB-style file with coordinates for d5bcac1.
(The format of our PDB-style files is described here.)

Timeline for d5bcac1: