Lineage for d1ac0__ (1ac0 -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55519Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 55520Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 55521Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 55578Protein Glucoamilase, granular starch-binding domain [49460] (1 species)
  7. 55579Species Aspergillus niger [49461] (4 PDB entries)
  8. 55582Domain d1ac0__: 1ac0 - [22526]

Details for d1ac0__

PDB Entry: 1ac0 (more details)

PDB Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, minimized average structure

SCOP Domain Sequences for d1ac0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ac0__ b.3.1.1 (-) Glucoamilase, granular starch-binding domain {Aspergillus niger}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOP Domain Coordinates for d1ac0__:

Click to download the PDB-style file with coordinates for d1ac0__.
(The format of our PDB-style files is described here.)

Timeline for d1ac0__: