Lineage for d1ac0__ (1ac0 -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) 
Protein Glucoamilase, granular starch-binding domain [49460] (1 species) Species Aspergillus niger [49461] (4 PDB entries) 
Domain d1ac0__: 1ac0 - [22526]
Details for d1ac0__
PDB Entry: 1ac0 (more details)
PDB Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, minimized average structure
SCOP Domain Sequences for d1ac0__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ac0__ b.3.1.1 (-) Glucoamilase, granular starch-binding domain {Aspergillus niger}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
SCOP Domain Coordinates for d1ac0__:
Click to download the PDB-style file with coordinates for d1ac0__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ac0__:
- d1ac0__ appears in SCOP 1.57
- d1ac0__ appears in the current release, SCOPe 2.08, called d1ac0a_
View in 3D