Lineage for d1kuma_ (1kum A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790367Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 790368Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 790474Protein Glucoamylase, granular starch-binding domain [49460] (1 species)
  7. 790475Species Aspergillus niger [TaxId:5061] [49461] (4 PDB entries)
  8. 790479Domain d1kuma_: 1kum A: [22525]

Details for d1kuma_

PDB Entry: 1kum (more details)

PDB Description: glucoamylase, granular starch-binding domain, nmr, minimized average structure
PDB Compounds: (A:) glucoamylase

SCOP Domain Sequences for d1kuma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kuma_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOP Domain Coordinates for d1kuma_:

Click to download the PDB-style file with coordinates for d1kuma_.
(The format of our PDB-style files is described here.)

Timeline for d1kuma_: