Lineage for d1kum__ (1kum -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) 
Protein Glucoamilase, granular starch-binding domain [49460] (1 species) Species Aspergillus niger [49461] (4 PDB entries) 
Domain d1kum__: 1kum - [22525]
Details for d1kum__
PDB Entry: 1kum (more details)
PDB Description: glucoamylase, granular starch-binding domain, nmr, minimized average structure
SCOP Domain Sequences for d1kum__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kum__ b.3.1.1 (-) Glucoamilase, granular starch-binding domain {Aspergillus niger}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
SCOP Domain Coordinates for d1kum__:
Click to download the PDB-style file with coordinates for d1kum__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kum__:
- d1kum__ appears in SCOP 1.57
- d1kum__ appears in the current release, SCOPe 2.08, called d1kuma_
View in 3D