Class b: All beta proteins [48724] (144 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein Glucoamylase, granular starch-binding domain [49460] (1 species) |
Species Aspergillus niger [49461] (4 PDB entries) |
Domain d1acz__: 1acz - [22524] |
PDB Entry: 1acz (more details)
SCOP Domain Sequences for d1acz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1acz__ b.3.1.1 (-) Glucoamylase, granular starch-binding domain {Aspergillus niger} cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
Timeline for d1acz__: