Lineage for d1acz__ (1acz -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457078Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) (S)
  5. 457079Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 457178Protein Glucoamylase, granular starch-binding domain [49460] (1 species)
  7. 457179Species Aspergillus niger [49461] (4 PDB entries)
  8. 457181Domain d1acz__: 1acz - [22524]

Details for d1acz__

PDB Entry: 1acz (more details)

PDB Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures

SCOP Domain Sequences for d1acz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acz__ b.3.1.1 (-) Glucoamylase, granular starch-binding domain {Aspergillus niger}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOP Domain Coordinates for d1acz__:

Click to download the PDB-style file with coordinates for d1acz__.
(The format of our PDB-style files is described here.)

Timeline for d1acz__: