Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
Protein Glucoamylase, granular starch-binding domain [49460] (1 species) |
Species Aspergillus niger [TaxId:5061] [49461] (4 PDB entries) |
Domain d1kula_: 1kul A: [22523] |
PDB Entry: 1kul (more details)
SCOPe Domain Sequences for d1kula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr
Timeline for d1kula_: