Lineage for d1kul__ (1kul -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10499Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 10500Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 10501Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 10556Protein Glucoamilase, granular starch-binding domain [49460] (1 species)
  7. 10557Species Aspergillus niger [49461] (4 PDB entries)
  8. 10559Domain d1kul__: 1kul - [22523]

Details for d1kul__

PDB Entry: 1kul (more details)

PDB Description: glucoamylase, granular starch-binding domain, nmr, 5 structures

SCOP Domain Sequences for d1kul__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kul__ b.3.1.1 (-) Glucoamilase, granular starch-binding domain {Aspergillus niger}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOP Domain Coordinates for d1kul__:

Click to download the PDB-style file with coordinates for d1kul__.
(The format of our PDB-style files is described here.)

Timeline for d1kul__: